tundra-node
guest@tundra-node:~$
Elias Zeiner
I'm a high school senior studying network security at a local vocational tech school. I build privacy-focused tools, run a homelab, and write about what I learn.
stuff i do
- cybersecurity student working toward a network security certificate
- Eagle Scout candidate
- FBLA. 5th at PA State 2026, NLC qualifier
- homelab. two servers, self-hosted media stack, WireGuard, Pi-hole
- open source. tools for I2P, privacy, and theater sound
interests
- cybersecurity and red teaming
- privacy and anti-surveillance
- jazz guitar and music
- retro computing
- fitness
- ChronicleA "life operating system" desktop app for everyday users. Personal tracking in Rust with egui.rusteguisqlite
- CueKeeperLAN-based theater sound cue manager. Load audio, sequence cues, trigger locally or remotely over WebSocket.pythonwebsockets
- FBLA Cybersecurity Study AppInteractive 100-question study app for FBLA Cybersecurity with flashcards, mock quizzes, and a progress tracker.reacttypescriptvitetailwind
- I2P Easy ManagerLightweight tool for simplified I2P network access with automated I2Pd and Firefox setup.python
- NexusMonorepo for two self-hosted I2P tools. A public I2P search engine and a router dashboard.reactpythonfastapidocker
- Nix ConfigPersonal NixOS and home-manager configuration with declarative system management.nixnixos
- FBLA SLC 2026Mar 10, 2026
- Sites & Apps I Can't Live WithoutJan 4, 2026
- New BlogDec 30, 2025
- Hosting an I2P EepsiteStep-by-step guide to hosting your own website on the I2P network using I2Pd and Caddy.
subscribe: /rss.xml